Protein coding transcript 114556

• Transcript: Ll_transcript_398929
• CDS coordinates: 288-701 (+)
• Peptide sequence: MSNVCSCYMKRLDYGFRGFQVPPTARRPRSTRWRGPSKKPAEVGQACAFELLASLAGRLLQESESSASSNASEGNNHPAFSQSVLEKERQDEVKPLMAKGIHNGSCAECTFKTEMESQKEFIMEVVQSVLLRLRWNHK
• ORF Type: 3prime_partial

Annotations of Ll_transcript_398929

• Blastp: Telomere repeat-binding protein 5 from Arabidopsis with 50.94% of identity
• Blastx: Telomere repeat-binding protein 5 from Arabidopsis with 50.98% of identity
• Eggnog: Telomere repeat-binding protein(ENOG4111PQU)
• Kegg: Link to kegg annotations (AT1G07540)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019455794.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;