Protein coding transcript 114557

• Transcript: Ll_transcript_398930
• CDS coordinates: 273-923 (+)
• Peptide sequence: MAMLGGGLHVGVLLHGKKVRDDKRTLRQSGISCEESLDKLGFMLEPSSMQASPSVCVGDASPCKTSQRVRSPETPVLDSGITNALHDSSLLTNNVNLVESNHDSNSFSTDPIADKIATDSRALVTVPTRSTEALAVVPVGQKTRHSELVQRRTRRPFSVSEVEALVEAVEELGTGRWRDVKLQAFENADYRTYVDLKVLSFIILDTVLFFYRSYFF*
• ORF Type: complete

Annotations of Ll_transcript_398930

• Blastp: Telomere repeat-binding protein 3 from Arabidopsis with 55.33% of identity
• Blastx: Telomere repeat-binding protein 3 from Arabidopsis with 58.37% of identity
• Eggnog: Telomere repeat-binding protein(ENOG4111C5T)
• Kegg: Link to kegg annotations (AT3G12560)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019455794.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;