Transcript | Ll_transcript_399198 |
---|---|
CDS coordinates | 130-492 (+) |
Peptide sequence | MNHKANVSKELNAKHKKILEGLLKLPENKECADCKAKGPRWASVNLGIFICMQCSGIHRSLGVHISKVRSATLDTWLPEQVAFIQSMGNEKANSYWEAELPPRYDRVGIENFIRAKYVCF* |
ORF Type | complete |
Blastp | Probable ADP-ribosylation factor GTPase-activating protein AGD5 from Arabidopsis with 93.16% of identity |
---|---|
Blastx | Probable ADP-ribosylation factor GTPase-activating protein AGD5 from Arabidopsis with 93.16% of identity |
Eggnog | domain, ankyrin repeat and PH domain(COG5347) |
Kegg | Link to kegg annotations (AT5G54310) |
CantataDB | Link to cantataDB annotations (CNT0001038) |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019449130.1) |
Pfam | Putative GTPase activating protein for Arf (PF01412.17) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer