Protein coding transcript 114588

• Transcript: Ll_transcript_398413
• CDS coordinates: 141-530 (+)
• Peptide sequence: MERRRHEPIITTNGRSSLWRRTMATPGSAAGSGGGSSEGSSAKAMVAEQISQAVQSTSNLLHLMQHSSPAQVKLSMLPKNLLAKVPTIKNTEQILEQMPGVISSLDAHMDYGLQKLELSFCMTEYTVLL*
• ORF Type: complete

Annotations of Ll_transcript_398413

• Blastp: Tobamovirus multiplication protein 2B from Arabidopsis with 58.24% of identity
• Blastx: Tobamovirus multiplication protein 2B from Arabidopsis with 64.79% of identity
• Eggnog: NA(ENOG410YYR9)
• Kegg: Link to kegg annotations (AT1G32370)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019443807.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;