Transcript | Ll_transcript_398416 |
---|---|
CDS coordinates | 187-804 (+) |
Peptide sequence | MDSTSGNGTGSPCGACKFLRRKCAPDCIFAPYFCSEQGADRFAAIHKVFGASNVSKLLFNIPAHDRCEAVVTIAYEAQARIRDPVYGCVSHIFALQQQVACLQAQLMQAKAQLAHQNLIENQWSGNVAAKPFNPFCLTSMMNPISPQSSLESSIDHSSTSDGMSMQDTQSIEDSSFQTWAKKISYNNDFGELQDLALRMMQRNYN* |
ORF Type | complete |
Blastp | LOB domain-containing protein 16 from Arabidopsis with 53.69% of identity |
---|---|
Blastx | LOB domain-containing protein 16 from Arabidopsis with 48.58% of identity |
Eggnog | lob domain-containing protein(ENOG410YA3N) |
Kegg | Link to kegg annotations (AT2G42430) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019441931.1) |
Pfam | Lateral organ boundaries (LOB) domain (PF03195.13) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer