Protein coding transcript 114593

• Transcript: Ll_transcript_398431
• CDS coordinates: 187-804 (+)
• Peptide sequence: MDSTSGNGTGSPCGACKFLRRKCAPDCIFAPYFCPEEGAHRIAAIHKVFGASNVSKLLMHIPAHDRCEAVVTIAYEAQARIRDPVYGCVSHIFALQQQVACLQAQLMQAKAQLAHQNLIENQWSGNVAAKPFNPFCLTSMMNPISPQSSLESSIDHSSTSDGMSMQDTQSIEDSSFQTWAKKISYNNDFGELQDLALRMMQRNYN*
• ORF Type: complete

Annotations of Ll_transcript_398431

• Blastp: LOB domain-containing protein 16 from Arabidopsis with 51.42% of identity
• Blastx: LOB domain-containing protein 16 from Arabidopsis with 48.18% of identity
• Eggnog: lob domain-containing protein(ENOG410YA3N)
• Kegg: Link to kegg annotations (AT2G42430)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019441931.1)
• Pfam: Lateral organ boundaries (LOB) domain (PF03195.13)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;