Protein coding transcript 114600

• Transcript: Ll_transcript_398419
• CDS coordinates: 112-495 (+)
• Peptide sequence: MAAPLFLRTPTFHTLSLNKHFTLPSTLNIKSLSILNFAKMEGSGIVEQVQEKLSVKKVFVAGATGSTGKRIVEQLLAKGYAVKAGVRDLDKARTIFSSDNPSLQLVSFFLSFSSNEIGLLGNNIAEE*
• ORF Type: complete

Annotations of Ll_transcript_398419

• Blastp: Uncharacterized protein At2g34460, chloroplastic from Arabidopsis with 49.06% of identity
• Blastx: Uncharacterized protein At2g34460, chloroplastic from Arabidopsis with 47.47% of identity
• Eggnog: epimerase dehydratase(COG0702)
• Kegg: Link to kegg annotations (AT2G34460)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019433781.1)
• Pfam: NmrA-like family (PF05368.12)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;