Transcript | Ll_transcript_398425 |
---|---|
CDS coordinates | 112-621 (+) |
Peptide sequence | MAAPLFLRTPTFHTLSLNKHFTLPSTLNIKSLSILNFAKMEGSGIVEQVQEKLSVKKVFVAGATGSTGKRIVEQLLAKGYAVKAGVRDLDKARTIFSSDNPSLQLVKADVTEGSDKLAEAIGDDSEAVVCATGFRPGWDLRAPWKVCHFCSCLRLMVIVKLNIFICHFC* |
ORF Type | complete |
Blastp | Uncharacterized protein At2g34460, chloroplastic from Arabidopsis with 55.26% of identity |
---|---|
Blastx | Uncharacterized protein At2g34460, chloroplastic from Arabidopsis with 73.61% of identity |
Eggnog | epimerase dehydratase(COG0702) |
Kegg | Link to kegg annotations (AT2G34460) |
CantataDB | Link to cantataDB annotations (CNT0000254) |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019433781.1) |
Pfam | NmrA-like family (PF05368.12) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer