Protein coding transcript 114664

• Transcript: Ll_transcript_399979
• CDS coordinates: 270-611 (+)
• Peptide sequence: MKALILVGGFGTRLRPLTLSVPKPLVDFANKPMILHQIEALKAIGVNEVVLAINYRPEVMMNFLKEFEAKLGIKITCSQETEPLGTAGPLALARDKLIDDSGKPFFVLNSDVIS
• ORF Type: 3prime_partial

Annotations of Ll_transcript_399979

• Blastp: Probable mannose-1-phosphate guanylyltransferase 2 from Oryza sativa with 90.35% of identity
• Blastx: Probable mannose-1-phosphate guanylyltransferase 2 from Oryza sativa with 90.35% of identity
• Eggnog: nucleotidyl transferase(COG1208)
• Kegg: Link to kegg annotations (4327472)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_007163469.1)
• Pfam: Nucleotidyl transferase (PF00483.22)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;