Transcript | Ll_transcript_397139 |
---|---|
CDS coordinates | 817-1677 (+) |
Peptide sequence | MRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLRADYIKMFVLDEADEMLSRGFKDQIYDIFQLLPSKIQVGVFSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFHVNVEKEEWKLDTLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTKDDERMLYDIQKFYNVIIEELPSNVAELL* |
ORF Type | complete |
Blastp | Eukaryotic initiation factor 4A-1 from Oryza sativa with 96.5% of identity |
---|---|
Blastx | Eukaryotic initiation factor 4A-1 from Oryza sativa with 96.34% of identity |
Eggnog | purine NTP-dependent helicase activity(COG0513) |
Kegg | Link to kegg annotations (4341966) |
CantataDB | - |
Mirbase | lja-MIR7534 (MI0024418) |
Ncbi protein | Link to NCBI protein (XP_019415274.1) |
Pfam | DEAD/DEAH box helicase (PF00270.28) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer