Protein coding transcript 114745

• Transcript: Ll_transcript_397113
• CDS coordinates: 144-794 (+)
• Peptide sequence: MAAAPEGSQFDAKQFDSKMNDLLTSEGQDFFTSYDEVHDSFDAMGLQENLLRGIYAYGFEKPSAIQQRGIVPFCQGLDVIQQAQSGTGKTATFCSGILQQLDYSVTECQALVLAPTRELAQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLRADYIKMFVLDEADEMLSRGFKDQVLFNSQLLLSSFFNY*
• ORF Type: complete

Annotations of Ll_transcript_397113

• Blastp: Eukaryotic initiation factor 4A-15 from Nicotiana with 89.9% of identity
• Blastx: Eukaryotic initiation factor 4A-1 from Oryza sativa with 96.21% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (107814763)
• CantataDB: -
• Mirbase: lja-MIR7534 (MI0024418)
• Ncbi protein: Link to NCBI protein (XP_019415274.1)
• Pfam: DEAD/DEAH box helicase (PF00270.28)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;