Protein coding transcript 114861

• Transcript: Ll_transcript_473643
• CDS coordinates: 1098-1934 (+)
• Peptide sequence: MLGRKELFKNTLRKATYAWKRIIELRLNEEEASMLRSFVDEPAFTDLHWGMFVPAIKGQGTDEQQKKWLPLAQKMQIIGCYAQTELGHGSNVQGLETTATFDHKTDEFVLNSPTLTSSKWWPGGLGKISTHAVVYARLIIDDKDYGVHGFIAQLRSLNDHLPLPGITIGDIGMKFGSAAYNSMDNGVLRFDHVRIPRNQMLMRVSQVTREGKYVHSSVPRQLVYGTMVYVRQIIVFDASVALSRAVCIATRYSAVRRQFGSHNGGPETQVSFRTLIDA*
• ORF Type: complete

Annotations of Ll_transcript_473643

• Blastp: Peroxisomal acyl-coenzyme A oxidase 1 from Arabidopsis with 81.41% of identity
• Blastx: Peroxisomal acyl-coenzyme A oxidase 1 from Arabidopsis with 80.58% of identity
• Eggnog: acyl-CoA dehydrogenase(COG1960)
• Kegg: Link to kegg annotations (AT4G16760)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019423731.1)
• Pfam: Acyl-coenzyme A oxidase N-terminal (PF14749.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;