Protein coding transcript 114862

• Transcript: Ll_transcript_473654
• CDS coordinates: 295-1212 (+)
• Peptide sequence: MGGGVDHLAPERNKAEFDVDSLKIVWAGSSHDLQLSERMSRLVASDPAFRKDNRAILGRKELFKNTLRKATYAWKRINELRLTEEEAYKFRTFVDEPAFTDLHWGMFVPAIKGQGTDEQQKKWLPLAQKMQIIGCYAQTELGHGSNVQGLETTATFDPETDEFVIHSPTLTSSKWWPGGLGKVSTHAVVYARLIIAGQDHGVNGFIVQLRSLDDHLPLPGITIGDIGAKFGNGAYNTMDNGVLRFDKVRIPRDQMLMRISQVTREGKLVQSSVPRQLVYGTMVFVRQAIVADASVAMSRAVCIATR
• ORF Type: 3prime_partial

Annotations of Ll_transcript_473654

• Blastp: Putative peroxisomal acyl-coenzyme A oxidase 1.2 from Arabidopsis with 78.15% of identity
• Blastx: Putative peroxisomal acyl-coenzyme A oxidase 1.2 from Arabidopsis with 78.15% of identity
• Eggnog: acyl-CoA dehydrogenase(COG1960)
• Kegg: Link to kegg annotations (AT2G35690)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019446070.1)
• Pfam: Acyl-coenzyme A oxidase N-terminal (PF14749.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;