Transcript | Ll_transcript_473653 |
---|---|
CDS coordinates | 2-352 (+) |
Peptide sequence | YARLIIDDKDYGVHDFLVQLRSLDNHLTLPGITIGDIGMKFGSGAYNTMDNGSLIFNHVRIPRNQMLMRLAQVTREGKYVPSEVPRQLSYSTMVYVRQKIVFDASIALSRAVCIATR |
ORF Type | internal |
Blastp | Putative peroxisomal acyl-coenzyme A oxidase 1.2 from Arabidopsis with 76.07% of identity |
---|---|
Blastx | Putative peroxisomal acyl-coenzyme A oxidase 1.2 from Arabidopsis with 76.07% of identity |
Eggnog | acyl-CoA dehydrogenase(COG1960) |
Kegg | Link to kegg annotations (AT2G35690) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019445035.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer