Transcript | Ll_transcript_471818 |
---|---|
CDS coordinates | 213-656 (+) |
Peptide sequence | MDRCFRFFPCLVDPGRRSSLWLKLAFVTIHVVYIAILFLFDGDLVEKTRKEPWYTALYLLLCAVTLIQYFATSIASPGYALNAMRAVNERNAVYRQTSETSNQSASSRNGSFIVTVEGNLIGRNVSGSNASDWSKLVADLYSASPIR* |
ORF Type | complete |
Blastp | Protein S-acyltransferase 10 from Arabidopsis with 50.71% of identity |
---|---|
Blastx | Protein S-acyltransferase 10 from Arabidopsis with 48.63% of identity |
Eggnog | Zinc finger, DHHC-type containing(COG5273) |
Kegg | Link to kegg annotations (AT3G51390) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019421300.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer