Protein coding transcript 114890

• Transcript: Ll_transcript_471821
• CDS coordinates: 387-1073 (+)
• Peptide sequence: MEFAGATATLSKKLSNGYGVSGRSAYDGVFAAPVKLRASSFSSRLEDYREVFGSFGASSIPVLEVPELKERKKNDDIRHSKLDYSKVFGGIGNLEAAVPFEELIREPKHKKRNSFSMGESPERSKAKGGNQSCREDPTKYSKENPTLLRSSNDTSRINMSYLMVNQGSDVAQIHAVPAYTCLIEEVNPVKVNRDNPVKVKRDNPVNVNRDNPVKVKRDNPVNVNRDNPV
• ORF Type: 3prime_partial

Annotations of Ll_transcript_471821

• Blastp: Auxilin-like protein 1 from Arabidopsis with 39.13% of identity
• Blastx: Auxilin-like protein 1 from Arabidopsis with 40.4% of identity
• Eggnog: UBA TS-N domain protein(ENOG410YGT5)
• Kegg: Link to kegg annotations (AT1G75310)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019458164.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;