Transcript | Ll_transcript_471838 |
---|---|
CDS coordinates | 387-758 (+) |
Peptide sequence | MEFAGATATLSKKLSNGYGVSGRSAYDGVFAAPVKLRASSFSSRLEDYREVFGSFGASSIPVLEVPELKERKKNDDIRHSKLDYSKVFGGIGNLEAAVPFEELIREPKHKKRNSFSMGESPER* |
ORF Type | complete |
Blastp | Auxilin-like protein 1 from Arabidopsis with 43.65% of identity |
---|---|
Blastx | Auxilin-like protein 1 from Arabidopsis with 42.22% of identity |
Eggnog | UBA TS-N domain protein(ENOG410YGT5) |
Kegg | Link to kegg annotations (AT1G75310) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019458164.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer