Transcript | Ll_transcript_473323 |
---|---|
CDS coordinates | 380-1342 (+) |
Peptide sequence | MSTSDDKPEIVERGTKDEKHEGDDKEEGKGGFIEKVKDFIHDIGEKIEEAIGFGKPTADVTAIHVPLINLHKADIVVDVLVKNPNPVPIPLIDINYLVESDGRKLVSGLIPDAGTIKAHGEETVKIPLTLIYDDIKQTYADIKPGSIIPYRVKVDLIVDVPILGRLTIPLEKTGEIPIPYKPDIDLEKINFERFSFEETIANLHLKLENKNDFDLGLNSLDYEVWLGDVSIGGAELTKSAKIEKSGIAYIDIPITFRPKDFGSALWDMIRGKGTGYTMKGNIDVDSPFGKMKLPISKEGGTTRLKKNKEDRDNYDDDDDED |
ORF Type | 3prime_partial |
Blastp | Late embryogenesis abundant protein Lea14-A from Gossypium with 32.03% of identity |
---|---|
Blastx | Desiccation protectant protein Lea14 homolog from Soja with 31.39% of identity |
Eggnog | - |
Kegg | Link to kegg annotations (107922715) |
CantataDB | Link to cantataDB annotations (CNT0001040) |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019460279.1) |
Pfam | Late embryogenesis abundant protein (PF03168.12) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer