Protein coding transcript 114920

• Transcript: Ll_transcript_473342
• CDS coordinates: 184-1146 (+)
• Peptide sequence: MSTSDDKPEIVERGTKDEKHEGDDKEEGKGGFIEKVKDFIHDIGEKIEEAIGFGKPTADVTAIHVPLINLHKADIVVDVLVKNPNPVPIPLIDINYLVESDGRKLVSGLIPDAGTIKAHGEETVKIPLTLIYDDIKQTYADIKPGSIIPYRVKVDLIVDVPILGRLTIPLEKTGEIPIPYKPDIDLEKINFERFSFEETIANLHLKLENKNDFDLGLNSLDYEVWLGDVSIGGAELTKSAKIEKSGIAYIDIPITFRPKDFGSALWDMIRGKGTGYTMKGNIDVDSPFGKMKLPISKEGGTTRLKKNKEDRDNYDDDDDED
• ORF Type: 3prime_partial

Annotations of Ll_transcript_473342

• Blastp: Late embryogenesis abundant protein Lea14-A from Gossypium with 32.03% of identity
• Blastx: Desiccation protectant protein Lea14 homolog from Soja with 31.39% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (107922715)
• CantataDB: Link to cantataDB annotations (CNT0001040)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019460277.1)
• Pfam: Late embryogenesis abundant protein (PF03168.12)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;