Transcript | Ll_transcript_474460 |
---|---|
CDS coordinates | 148-774 (+) |
Peptide sequence | MELQQNEFDRLFFFEHARKTAEAEYAINPLDADNLTRWGGALLELSQFQGLPESKKMTQEAVSKLEEALAINPKKHDTLWCLGNAYTSQAFLIPDQEEAKPYFDKAAEYFQQAVDEDSTNELYQKSLEVAAKAPELHVEIHKHGFGQQQQAAAPAGPSTSSGTKTQKKKKSSDLKYDIFGWVILAVGIVAWVGFAKSNIPPPPPPPLR* |
ORF Type | complete |
Blastp | Mitochondrial import receptor subunit TOM20 from Solanum with 72.86% of identity |
---|---|
Blastx | Mitochondrial import receptor subunit TOM20 from Solanum with 71.86% of identity |
Eggnog | - |
Kegg | Link to kegg annotations (102603648) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019428099.1) |
Pfam | Plant specific mitochondrial import receptor subunit TOM20 (PF06552.11) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer