Protein coding transcript 114976

• Transcript: Ll_transcript_474302
• CDS coordinates: 957-1466 (+)
• Peptide sequence: MVLEFLGDNLLRLIKYNHYKGLPLNKVREICKCILIGLDYLHSELGIIHSDLKPENILLFSTIDHSKDPCRSGLSPILERPEGNINVGVTSLIEKRLKRRARRAVAKISLKRDSMGGSGEPPKSDRNIDGVDVRCKIVDFGNACWADKPLAEEIQTRQYRAPEVILKAGY
• ORF Type: 3prime_partial

Annotations of Ll_transcript_474302

• Blastp: Serine/threonine-protein kinase SRPK from Physarum with 42.53% of identity
• Blastx: Serine/threonine-protein kinase SRPK from Physarum with 41.85% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019420449.1)
• Pfam: Protein kinase domain (PF00069.24)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;