Protein coding transcript 115034

• Transcript: Ll_transcript_473425
• CDS coordinates: 214-1020 (+)
• Peptide sequence: MSSIRRLSGEESQALYSLLKAEQRPIHEIVSEFNSNISRTRHFTLCSYLLMLLQDNKILNTTQRLIAFSLLLEAYASQKPASNPFISFILNAACHEDSERVVRAFILQLLGVDGSISGKEFLKQSASDYVKGFDQSLHDFPSLDQLQQQFPDDVHLEPYHHLFKDGSVKNVVPDPDVPSNCDIDSPEFDLHPGSKPKIGSGDKEEAVVGLLSNFSLEGLRPHWIRPIPPRLPILDEELVWLNPDDNHELMWDYSMCIDTSRGAAVRDLI
• ORF Type: 3prime_partial

Annotations of Ll_transcript_473425

• Blastp: CCR4-NOT transcription complex subunit 11 from Danio with 27.61% of identity
• Blastx: CCR4-NOT transcription complex subunit 11 from Danio with 25.48% of identity
• Eggnog: chromosome 2 open reading frame 29(ENOG410XPKT)
• Kegg: Link to kegg annotations (336124)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019432523.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;