Protein coding transcript 115038

• Transcript: Ll_transcript_473437
• CDS coordinates: 2539-3288 (+)
• Peptide sequence: MHLNVCVIFVLIIHGIMFAVAAYLLPYFLLDDMFVFSFKLWCFSITGGLQFLKQSASDYVKGFDQSLHDFPSLDQLQQQFPDDVHLEPYHHLFKDGSVKNVVPDPDVPSNCDIDSPEFDLHPGSKPKIGSGDKEEAVVGLLSNFSLEGLRPHWIRPIPPRLPILDEELVWLNPDDNHELMWDYSMCIDTSRGAAVRDLIANALKGALAPAQQEVTIVFVDKTSIKCREEKNKKILVICRIRNHVQKKGK*
• ORF Type: complete

Annotations of Ll_transcript_473437

• Blastp: CCR4-NOT transcription complex subunit 11 from Danio with 36.52% of identity
• Blastx: CCR4-NOT transcription complex subunit 11 from Homo with 87.63% of identity
• Eggnog: chromosome 2 open reading frame 29(ENOG410XPKT)
• Kegg: Link to kegg annotations (336124)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019432523.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;