Transcript | Ll_transcript_473442 |
---|---|
CDS coordinates | 2539-3288 (+) |
Peptide sequence | MHLNVCVIFVLIIHGIMFAVAAYLLPYFLLDDMFVFSFKLWCFSITGGLQFLKQSASDYVKGFDQSLHDFPSLDQLQQQFPDDVHLEPYHHLFKDGSVKNVVPDPDVPSNCDIDSPEFDLHPGSKPKIGSGDKEEAVVGLLSNFSLEGLRPHWIRPIPPRLPILDEELVWLNPDDNHELMWDYSMCIDTSRGAAVRDLIANALKGALAPAQQEVTIVFVDKTSIKCREEKNKKILVICRIRNHVQKKGK* |
ORF Type | complete |
Blastp | CCR4-NOT transcription complex subunit 11 from Danio with 36.52% of identity |
---|---|
Blastx | CCR4-NOT transcription complex subunit 11 from Homo with 86.49% of identity |
Eggnog | chromosome 2 open reading frame 29(ENOG410XPKT) |
Kegg | Link to kegg annotations (336124) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019432523.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer