Protein coding transcript 115048

• Transcript: Ll_transcript_473453
• CDS coordinates: 2539-3492 (+)
• Peptide sequence: MHLNVCVIFVLIIHGIMFAVAAYLLPYFLLDDMFVFSFKLWCFSITGGLQFLKQSASDYVKGFDQSLHDFPSLDQLQQQFPDDVHLEPYHHLFKDGSVKNVVPDPDVPSNCDIDSPEFDLHPGSKPKIGSGDKEEAVVGLLSNFSLEGLRPHWIRPIPPRLPILDEELVWLNPDDNHELMWDYSMCIDTSRGAAVRDLIANALKGALAPAQQEKVLVELANDPKLVYHCGLTPRKLPELVENNPLIAIDVLIKLINSPEIAEYFTVLVNMDMSLHSMEVVNRLTTTVELPSEFIHMYITNCISSCVNIKVLHFAFVL*
• ORF Type: complete

Annotations of Ll_transcript_473453

• Blastp: CCR4-NOT transcription complex subunit 11 from Homo with 53.3% of identity
• Blastx: CCR4-NOT transcription complex subunit 11 from Homo with 61.64% of identity
• Eggnog: chromosome 2 open reading frame 29(ENOG410XPKT)
• Kegg: Link to kegg annotations (55571)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019432523.1)
• Pfam: Uncharacterized conserved protein (DUF2363) (PF10155.8)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;