Transcript | Ll_transcript_473923 |
---|---|
CDS coordinates | 181-936 (+) |
Peptide sequence | MNTLLPRIGVGLCTPRLLHQPPHSSKKPYKLTSGTVSFSVTCSASKWAERLVSDFQFTDDTSSDNHHSHSSTATLSPSLPPPPLDPPERHLSIPLDFYQILGAETHFLGDGIRRAYEAKFSKPPQYAFSNEALISRRQILEAAFETLVDPASRREYNQSLIDDENGTILTEVPFHKVPGALCALQEAGDTELVLQIGHDLLKERLPKSFKQDVVLAMALAYVDISRDAMALSPPDFTVGCEMLERALKLLQ* |
ORF Type | complete |
Blastp | Protein ACCUMULATION AND REPLICATION OF CHLOROPLASTS 6, chloroplastic from Arabidopsis with 62.1% of identity |
---|---|
Blastx | Protein ACCUMULATION AND REPLICATION OF CHLOROPLASTS 6, chloroplastic from Arabidopsis with 59.27% of identity |
Eggnog | DnaJ domain protein(ENOG410YJYY) |
Kegg | Link to kegg annotations (AT5G42480) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019458561.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer