Protein coding transcript 115066

• Transcript: Ll_transcript_471857
• CDS coordinates: 137-832 (+)
• Peptide sequence: MAMAVAHHRESSSNNSGSIDKHLDSISGKYVRYTAEQVEALERVYAECPKPSSLRRQQLIRECPILSNIDPKQIKVWFQNRRCREKQRKEASRLQSVNRKLSAMNKLLMEENDRLQKQVSQLVCENGFMRQQLHTTPAAATNASSDSVVTTTQHSLRDANNPAGLLSIAEETLTEFLSKATGTAVDWVQMPGMKPGPDSVGIFAISQSCGGVAARACGLVSLEPMKVSSPF*
• ORF Type: complete

Annotations of Ll_transcript_471857

• Blastp: Homeobox-leucine zipper protein REVOLUTA from Arabidopsis with 84.65% of identity
• Blastx: Homeobox-leucine zipper protein REVOLUTA from Arabidopsis with 84.65% of identity
• Eggnog: Homeobox-leucine zipper protein(ENOG410ZJBV)
• Kegg: Link to kegg annotations (AT5G60690)
• CantataDB: -
• Mirbase: cln-MIR166 (MI0022568)
• Ncbi protein: Link to NCBI protein (XP_016187430.1)
• Pfam: Homeobox domain (PF00046.28)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;