Transcript | Ll_transcript_471862 |
---|---|
CDS coordinates | 137-631 (+) |
Peptide sequence | MAMAVAHHRESSSNNSGSIDKHLDSISGKYVRYTAEQVEALERVYAECPKPSSLRRQQLIRECPILSNIDPKQIKVWFQNRRCREKQRKEASRLQSVNRKLSAMNKLLMEENDRLQKQVSQLVCENGFMRQQLHTTPAAATNASSDSVVTTTQHSLRDANNPAG* |
ORF Type | complete |
Blastp | Homeobox-leucine zipper protein REVOLUTA from Arabidopsis with 81.71% of identity |
---|---|
Blastx | Homeobox-leucine zipper protein REVOLUTA from Arabidopsis with 84.58% of identity |
Eggnog | Homeobox-leucine zipper protein(ENOG410ZJBV) |
Kegg | Link to kegg annotations (AT5G60690) |
CantataDB | - |
Mirbase | cln-MIR166 (MI0022568) |
Ncbi protein | Link to NCBI protein (XP_019453966.1) |
Pfam | Homeobox domain (PF00046.28) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer