Transcript | Ll_transcript_471890 |
---|---|
CDS coordinates | 3-617 (+) |
Peptide sequence | QIKVWFQNRRCREKQRKEASQLQTVNQKLTAMNKLLMEENDRLQKQVSQLVCENGYMRQQLHTPSARATDGSCDSAVTTPQHSTRDANNPAGFLSIAEETLAEFLSKATGTAVDWVQMPGMKPGPESVGIFAISQSCTGVAARACGLVSLEPTKVADILKDRPSWFRECRSLEVFTTVPAGNGGTIELVYTQVTIECEMYHPFN* |
ORF Type | 5prime_partial |
Blastp | Homeobox-leucine zipper protein REVOLUTA from Arabidopsis with 88.41% of identity |
---|---|
Blastx | Homeobox-leucine zipper protein REVOLUTA from Arabidopsis with 84.9% of identity |
Eggnog | Homeobox-leucine zipper protein(ENOG410ZJBV) |
Kegg | Link to kegg annotations (AT5G60690) |
CantataDB | Link to cantataDB annotations (CNT0000180) |
Mirbase | cln-MIR166 (MI0022568) |
Ncbi protein | Link to NCBI protein (XP_019447870.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer