Protein coding transcript 1153

• Transcript: Ll_transcript_494629
• CDS coordinates: 1-336 (+)
• Peptide sequence: SGQGEREFHAEIDIISRVHHRHLVSLVGYCISGGQRMLVYDFIPNNTLEYHLHGKGVPTMDWPTRMRIAIGSAKGLAYLHEDCHPRIIHRDIKAANVLIDDSFEAKVADFGL
• ORF Type: internal

Annotations of Ll_transcript_494629

• Blastp: Proline-rich receptor-like protein kinase PERK5 from Arabidopsis with 85.71% of identity
• Blastx: Proline-rich receptor-like protein kinase PERK5 from Arabidopsis with 85.71% of identity
• Eggnog: Serine Threonine protein kinase(COG0515)
• Kegg: Link to kegg annotations (AT4G34440)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019423405.1)
• Pfam: Protein tyrosine kinase (PF07714.16)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;