Protein coding transcript 115327

• Transcript: Ll_transcript_472411
• CDS coordinates: 109-642 (+)
• Peptide sequence: MSINLNSHAFADNPLLRSKPTDPLSPKAALQALNIRILETNTLSSSSPNFKVLPFKNSRPLASSTSDSPVPVFQLGWISLEDLKAFFENSGSQLCAEWLVYLGSSAEDDAVYWAIDVSDHSNLVTELCSREMGFVALLTLMVASDWEDLQAMRNLAIAGHVSSFCNIIHKFYNLFLK*
• ORF Type: complete

Annotations of Ll_transcript_472411

• Blastp: Nudix hydrolase 19, chloroplastic from Arabidopsis with 46.37% of identity
• Blastx: Nudix hydrolase 19, chloroplastic from Arabidopsis with 46.67% of identity
• Eggnog: NADH pyrophosphatase(COG2816)
• Kegg: Link to kegg annotations (AT5G20070)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019464610.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;