Protein coding transcript 115329

• Transcript: Ll_transcript_472384
• CDS coordinates: 115-540 (+)
• Peptide sequence: MEPLSSSSSSAIAQQTWELENNIIPMESPSSTTNADDSIFHYDEAAQSEFHREKPWINDPHYFKRVKISALALLKMVVHARSGGTIEVMGLMQGKTDKDAIIVMDAFALPVEGTETRVNAQADAYEYMVDYSQTNKQVWFF*
• ORF Type: complete

Annotations of Ll_transcript_472384

• Blastp: COP9 signalosome complex subunit 5b from Arabidopsis with 87.23% of identity
• Blastx: COP9 signalosome complex subunit 5b from Arabidopsis with 88.89% of identity
• Eggnog: Component of the eukaryotic translation initiation factor 3 (eIF-3) complex, which is involved in protein synthesis and, together with other initiation factors, stimulates binding of mRNA and methionyl-tRNAi to the 40S ribosome (By similarity)(COG1310)
• Kegg: Link to kegg annotations (AT1G71230)
• CantataDB: Link to cantataDB annotations (CNT0000267)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019416761.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;