Transcript | Ll_transcript_472410 |
---|---|
CDS coordinates | 110-1138 (+) |
Peptide sequence | MEALPSASIAQQTWEFENNIIPIDTPSSTTNADDSIFHFDEASQNQFHRQRPWINDPHFFKRVKISALALLKMVVHARSGGTIEVMGLMQGKTNKDSIIVMDAFALPVEGTETRVNAQADAYEYMVDYSQTNKQAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQQFQEPFLAVVIDPTRTVSAGKVEIGAFRTYPGDYKPPDDPISEYQTIPLNKIEDFGVHCKQYYSLDITYFKSSLDSHLLDLLWNKYWVNTLSSSPLMGNGDYFAGQISDLAEKLEQAENQLAHSRFGSLIAPSPRKKEEESPLAKITRDSAKITAEQVHGLMSQVIKDILFNSVH* |
ORF Type | complete |
Blastp | COP9 signalosome complex subunit 5b from Arabidopsis with 81.07% of identity |
---|---|
Blastx | COP9 signalosome complex subunit 5b from Arabidopsis with 80% of identity |
Eggnog | Component of the eukaryotic translation initiation factor 3 (eIF-3) complex, which is involved in protein synthesis and, together with other initiation factors, stimulates binding of mRNA and methionyl-tRNAi to the 40S ribosome (By similarity)(COG1310) |
Kegg | Link to kegg annotations (AT1G71230) |
CantataDB | Link to cantataDB annotations (CNT0000267) |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019438349.1) |
Pfam | JAB1/Mov34/MPN/PAD-1 ubiquitin protease (PF01398.20) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer