Protein coding transcript 115369

• Transcript: Ll_transcript_473385
• CDS coordinates: 2-904 (+)
• Peptide sequence: ANEIGVPVNQQRLIFRGKVLKDEHILSEYHLENGHTLHLVERQPNQSQVSGTSSAEPTVTNANQGNDAVSVAPRNRVGQISHSVVLGTINLGEQGGGMVPDLSGVIGAVLNSFGIGGQSRNSVSNATQTSAPSGNETEGIHAGNQNLAGNQAQPGQAFRGQAFQSLPQLVQIPVPAGTIPIPSLNAPIPHSLTTLSEFINNMEHTLSQNGHRPNLSSTNHGGQRIELPTNAQGLPTVEALSAILRRTGQLLSDNTVAALCVIIISHLIYKYSASPLFISDINIFLLFEFLGYLLSCQKLY*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_473385

• Blastp: Ubiquitin domain-containing protein DSK2 from Saccharomyces with 52.5% of identity
• Blastx: Ubiquitin domain-containing protein DSK2 from Saccharomyces with 52.5% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (YMR276W)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019453371.1)
• Pfam: Ubiquitin family (PF00240.22)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;