Protein coding transcript 1154

• Transcript: Ll_transcript_494622
• CDS coordinates: 3-728 (+)
• Peptide sequence: TLSEAYRNHPLHLHHIIPLDFSSIRTLPESHAWSESNDSDNIISYNESLSIPIIDLMDPYAMEQIGLACEEWGVFQLKNHGIPLSVIEEVEVESKKLFSLPAEQKLKALRSPGGATGYGRARISPFFPKYMWHEGFTFMGSSDDAKKIWPKDYEKFCDAMENYQKQMKILAEKLSHMILNFLGIKNCSSSSEENKWVGSTNHIGAIQLNFYPCCPEPNRAMGLAPHTDTSFLTILHQTLTNG
• ORF Type: internal

Annotations of Ll_transcript_494622

• Blastp: Gibberellin 3-beta-dioxygenase 1 from Pisum with 50.6% of identity
• Blastx: Gibberellin 3-beta-dioxygenase 1 from Pisum with 48.61% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019447534.1)
• Pfam: non-haem dioxygenase in morphine synthesis N-terminal (PF14226.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;