| Transcript | Ll_transcript_472564 |
|---|---|
| CDS coordinates | 374-706 (+) |
| Peptide sequence | MGYLNSVLSSSTQVHAVADAPVTGGGLSHNGKFSYGYASSPGRRSSMEDFYETRIDGVDGEIVGLFGVFDGHGGVRAAEYVKQNLFSNLISHPKFISDTKSAISDAYNHTD |
| ORF Type | 3prime_partial |
| Blastp | Probable protein phosphatase 2C 59 from Arabidopsis with 86.49% of identity |
|---|---|
| Blastx | Probable protein phosphatase 2C 59 from Arabidopsis with 86.49% of identity |
| Eggnog | Phosphatase(COG0631) |
| Kegg | Link to kegg annotations (AT4G31750) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019415301.1) |
| Pfam | - |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer