Transcript | Ll_transcript_472546 |
---|---|
CDS coordinates | 134-937 (+) |
Peptide sequence | MQFLFNLMKFITFFFIGVLVLFMQVHAAADAPVTGGGLSHNGKFSYGYASSPGRRSSMEDFYETRIDGVDGEIVGLFGVFDGHGGVRAAEYVKQNLFSNLISHPKFISDTKSAISDAYNHTDSEFLKSEHSHNRDAGSTASTAILVGDRLLVANVGDSRAVICRGGNAIAVSRDHKPDQTDERQRIEDAGGFVMWAGTWRVGGVLAVSRAFGDRLLKQYVVADPEIQEEKVDSSLEFLILASDGLWDVVSNEVCNDFDFFDFSLIKL* |
ORF Type | complete |
Blastp | Probable protein phosphatase 2C 59 from Arabidopsis with 89.54% of identity |
---|---|
Blastx | Probable protein phosphatase 2C 59 from Arabidopsis with 89.54% of identity |
Eggnog | Phosphatase(COG0631) |
Kegg | Link to kegg annotations (AT4G31750) |
CantataDB | Link to cantataDB annotations (CNT0001502) |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019437812.1) |
Pfam | Protein phosphatase 2C (PF00481.20) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer