Protein coding transcript 11567

• Transcript: Ll_transcript_317025
• CDS coordinates: 230-1006 (+)
• Peptide sequence: MASSSTLSLTFTLSSTITSSSSYLPIFTPTLLTKHHIHLFSSKHKHKHNHSLKQRVFSVSSSSSPSLEALIFDCDGVILESEHLHRQAYNDAFTHFNVRVPSSSSSYDDQQPLNWGIHFYDELQNRIGGGKPKMRWYFKEHGWPSSNVFETPPTDDDDRAKLIDTLQDWKTERYKEIIKSGTVEPRPGVLRLMDEAKAAGKKLAVCSAATKSSVILCLENLIGIERFQSLDCFLAGIFIPLLYISFSHITLRCSNFLY*
• ORF Type: complete

Annotations of Ll_transcript_317025

• Blastp: Haloacid dehalogenase-like hydrolase domain-containing protein At4g39970 from Arabidopsis with 77.13% of identity
• Blastx: Haloacid dehalogenase-like hydrolase domain-containing protein At4g39970 from Arabidopsis with 80.59% of identity
• Eggnog: HAD-superfamily hydrolase subfamily IA variant 3(COG0637)
• Kegg: Link to kegg annotations (AT4G39970)
• CantataDB: Link to cantataDB annotations (CNT0000554)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019462441.1)
• Pfam: Haloacid dehalogenase-like hydrolase (PF13419.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;