Protein coding transcript 115679

• Transcript: Ll_transcript_473967
• CDS coordinates: 129-812 (+)
• Peptide sequence: MYGHNTYQSDLALLDSICRHLISESEPKSRDPNHVSGNNPFYSRSSSFSSLYPCLTDNWGELPLKENDSEDMVLYGVLHDAVNVGWVPSFETGSSESNFSGEVVVKSEPDVMSPMTAPLVIMEAVPEKEKHYRGVRRRPWGKFAAEIRDPAKNGARVWLGTFETMEDAALAYDRAAYRIRGSRALLNFPLRVNSGEPDPVRVTSKRYLSENGSSSSSTKKRRKRVTT*
• ORF Type: complete

Annotations of Ll_transcript_473967

• Blastp: Ethylene-responsive transcription factor 1A from Arabidopsis with 56.12% of identity
• Blastx: Ethylene-responsive transcription factor 1A from Arabidopsis with 58.06% of identity
• Eggnog: Transcription factor(ENOG410YJV7)
• Kegg: Link to kegg annotations (AT4G17500)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019422784.1)
• Pfam: AP2 domain (PF00847.19)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;