Transcript | Ll_transcript_473749 |
---|---|
CDS coordinates | 301-726 (+) |
Peptide sequence | MGIPENIVVGSHVWVGDPELVWIDGQVLSINGDEADIQASNGKKVVSHLSKLHPKDTEAPTDGVDDMTKLAYLHEPGVLHNLEIRYKMNEIYTYTGNILIAINPFQSLPDLYDANMMKHYKGATLGDLSPHVFAIAEAAYR* |
ORF Type | complete |
Blastp | Myosin-11 from Arabidopsis with 68.57% of identity |
---|---|
Blastx | Myosin-11 from Arabidopsis with 65.44% of identity |
Eggnog | myosin heavy chain(COG5022) |
Kegg | Link to kegg annotations (AT1G54560) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019453133.1) |
Pfam | Myosin N-terminal SH3-like domain (PF02736.18) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer