Protein coding transcript 115722

• Transcript: Ll_transcript_473749
• CDS coordinates: 301-726 (+)
• Peptide sequence: MGIPENIVVGSHVWVGDPELVWIDGQVLSINGDEADIQASNGKKVVSHLSKLHPKDTEAPTDGVDDMTKLAYLHEPGVLHNLEIRYKMNEIYTYTGNILIAINPFQSLPDLYDANMMKHYKGATLGDLSPHVFAIAEAAYR*
• ORF Type: complete

Annotations of Ll_transcript_473749

• Blastp: Myosin-11 from Arabidopsis with 68.57% of identity
• Blastx: Myosin-11 from Arabidopsis with 65.44% of identity
• Eggnog: myosin heavy chain(COG5022)
• Kegg: Link to kegg annotations (AT1G54560)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019453133.1)
• Pfam: Myosin N-terminal SH3-like domain (PF02736.18)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;