Protein coding transcript 115728

• Transcript: Ll_transcript_473756
• CDS coordinates: 1741-2817 (+)
• Peptide sequence: MSRLVYKINVSIGQDPSSKFLIGVLDIYGFESFVSNSFEQFCINFTNEKLQQHFNQHVFKMEQEQYTKEGINWSYLEFVDNQDVLDLIEKKPGGIIALLDEACMFPKSTHETFSQKLYQTFKDHKRFVKPKLARSDFTVVHYAGEVQYRSELFLDKNKDYVVPEHQDMLSASRCSFVSGLFLPLSEETAKSAKFSSIGSRFKLQLQQLMETLNLTEPHYIRCVKPNNLLQPGIFENVNVIQQLRSGGVLEAVRIKCAGFPTHRTFHDFLTRVGILAPEVLLGNFNEKDSCKMILEKIGLSGYQIGETQIFLRAGQMAELDAQRARLLNNSATVIQKQIKTHFSRKTYVALRKSSIFIT*
• ORF Type: complete

Annotations of Ll_transcript_473756

• Blastp: Myosin-9 from Arabidopsis with 75.28% of identity
• Blastx: Myosin-9 from Arabidopsis with 69.88% of identity
• Eggnog: myosin heavy chain(COG5022)
• Kegg: Link to kegg annotations (AT1G08730)
• CantataDB: Link to cantataDB annotations (CNT0000134)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019453131.1)
• Pfam: Myosin head (motor domain) (PF00063.20)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;