Transcript | Ll_transcript_473718 |
---|---|
CDS coordinates | 1329-2402 (+) |
Peptide sequence | MSRLVYKINVSIGQDPSSKFLIGVLDIYGFESFVSNSFEQFCINFTNEKLQQHFNQHVFKMEQEQYTKEGINWSYLEFVDNQDVLDLIEKKPGGIIALLDEACMFPKSTHETFSQKLYQTFKDHKRFVKPKLARSDFTVVHYAGEVQYRSELFLDKNKDYVVPEHQDMLSASRCSFVSGLFLPLSEETAKSAKFSSIGSRFKLQLQQLMETLNLTEPHYIRCVKPNNLLQPGIFENVNVIQQLRSGGVLEAVRIKCAGFPTHRTFHDFLTRVGILAPEVLLGNFNEKDSCKMILEKIGLSGYQIGETQIFLRAGQMAELDAQRARLLNNSATVIQKQIKTHFSRKTYVALRKSSIFM* |
ORF Type | complete |
Blastp | Myosin-9 from Arabidopsis with 75.28% of identity |
---|---|
Blastx | Myosin-9 from Arabidopsis with 70.86% of identity |
Eggnog | myosin heavy chain(COG5022) |
Kegg | Link to kegg annotations (AT1G08730) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019453131.1) |
Pfam | Myosin head (motor domain) (PF00063.20) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer