Protein coding transcript 1158

• Transcript: Ll_transcript_427292
• CDS coordinates: 87-911 (+)
• Peptide sequence: MALSLCMMVPYNEVSDRASFSIPFLKIGWRWASNLVGAGASLGIVASLLVAMLGQARYLCVIGRARLVPSWLAKVHPSTGTPLNATLFLGLCTALIALFTELDIIIELVNIGTLMVFYLVANALIYRRYVVTQHTPPLHTVLFMLLLSLSALGFSMSWKFKQQWWGLPLFGGLMIIVTTFFQYMVPSHAQVAADWSVPLMPWPAAISIFLNVFLITTLKLLSFQRFAIWACVITIFYVLYGVHSTYKAEEIEMGANEVSSSTTNLQTKLELELL*
• ORF Type: complete

Annotations of Ll_transcript_427292

• Blastp: Cationic amino acid transporter 7, chloroplastic from Arabidopsis with 46.85% of identity
• Blastx: Cationic amino acid transporter 7, chloroplastic from Arabidopsis with 48.58% of identity
• Eggnog: amino acid(COG0531)
• Kegg: Link to kegg annotations (AT3G10600)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019421215.1)
• Pfam: Amino acid permease (PF13520.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;