Protein coding transcript 115803

• Transcript: Ll_transcript_473597
• CDS coordinates: 101-424 (+)
• Peptide sequence: MVRPLYPMRAPGPVNVLPVSRPPVAGVPAVRPIIPPVIRPVVAPSVTPAQKPQITVYVGKIAPTVENDFMLNLFQLCGPVKSWKRPQDLSSGNPKGFGFCEFESDEGV
• ORF Type: 3prime_partial

Annotations of Ll_transcript_473597

• Blastp: Uncharacterized RNA-binding protein C644.16 from Schizosaccharomyces with 41.51% of identity
• Blastx: Uncharacterized RNA-binding protein C644.16 from Schizosaccharomyces with 42.31% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (SPAC644.16)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019423639.1)
• Pfam: RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) (PF00076.21)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;