Transcript | Ll_transcript_473574 |
---|---|
CDS coordinates | 105-428 (+) |
Peptide sequence | MVRPLYPMRAPGPVNVLPVSRPPVAGVPAVRPIIPPVIRPVVAPSVTPAQKPQITVYVGKIAPTVENDFMLNLFQLCGPVKSWKRPQDLSSGNPKGFGFCEFESDEGV |
ORF Type | 3prime_partial |
Blastp | Uncharacterized RNA-binding protein C644.16 from Schizosaccharomyces with 41.51% of identity |
---|---|
Blastx | Uncharacterized RNA-binding protein C644.16 from Schizosaccharomyces with 42.31% of identity |
Eggnog | - |
Kegg | Link to kegg annotations (SPAC644.16) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019423639.1) |
Pfam | RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) (PF00076.21) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer