Protein coding transcript 1159

• Transcript: Ll_transcript_301281
• CDS coordinates: 2-337 (+)
• Peptide sequence: NLSEGKGKVSNSKFSGRIKIPNEEYESLSVKVKEYEELVEKKEAAMMAEVEAILRRKNEVERKIEANMNAIEEMKAATDMAMWDAEIADYAKVGIESRLRRFREQEQRVVT*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_301281

• Blastp: WEB family protein At1g12150 from Arabidopsis with 48.35% of identity
• Blastx: WEB family protein At1g12150 from Arabidopsis with 48.35% of identity
• Eggnog: Pfam:DUF827(ENOG410ZHIN)
• Kegg: Link to kegg annotations (AT1G12150)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019434943.1)
• Pfam: Weak chloroplast movement under blue light (PF05701.10)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;