Transcript | Ll_transcript_473681 |
---|---|
CDS coordinates | 1616-2428 (+) |
Peptide sequence | MDIAVRAHLCGWKFIFLNDVKCLCELPETYEAYKKQQHRWHSGPMQLFRLCFVDILRSKVSWAKKANLIFLFFLLRKLILPFYSFTLFCIILPLTMFLPEAELPAWVVCYLPGIMSILSVLPAPRSFPFIVPYLLFENTMSVTKFNAMISGLFRFGSSYEWVVTKKLGRSSETDLVALGKESEPLIRSTSLHRSSSDSGIEELSKLELSKKTGKTKRNRLYRKELALAFILLTASVRSLLSAQGIHFYFLLFQGISFLVVGLDLIGEQVS* |
ORF Type | complete |
Blastp | Probable xyloglucan glycosyltransferase 6 from Arabidopsis with 85.19% of identity |
---|---|
Blastx | Probable xyloglucan glycosyltransferase 6 from Arabidopsis with 87.32% of identity |
Eggnog | Glycosyl transferase, family 2(COG1215) |
Kegg | Link to kegg annotations (AT3G07330) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019463230.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer