Protein coding transcript 115988

• Transcript: Ll_transcript_473692
• CDS coordinates: 47-652 (+)
• Peptide sequence: MSCDYVKDYEFVAIFDADFQPTPDFLKKAVPYFKGNDDLALVQTRWAFVNKDENLLTRLQNVNLSFHFEVEQQVNGVFINFFGFNGTAGVWRIKALEESGGWLERTTVEDMDIAVRAHLCGWKFIFLNDVKCLCELPETYEAYKKQQHRWHSGPMQLFRLCFVDILRSKVLNSMHALFLVHLNSFKSRKVLLCDSSVTVCV*
• ORF Type: complete

Annotations of Ll_transcript_473692

• Blastp: Probable xyloglucan glycosyltransferase 6 from Arabidopsis with 82.19% of identity
• Blastx: Probable xyloglucan glycosyltransferase 6 from Arabidopsis with 82.19% of identity
• Eggnog: Glycosyl transferase, family 2(COG1215)
• Kegg: Link to kegg annotations (AT3G07330)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019465305.1)
• Pfam: Glycosyl transferase family 21 (PF13506.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;