Transcript | Ll_transcript_473692 |
---|---|
CDS coordinates | 47-652 (+) |
Peptide sequence | MSCDYVKDYEFVAIFDADFQPTPDFLKKAVPYFKGNDDLALVQTRWAFVNKDENLLTRLQNVNLSFHFEVEQQVNGVFINFFGFNGTAGVWRIKALEESGGWLERTTVEDMDIAVRAHLCGWKFIFLNDVKCLCELPETYEAYKKQQHRWHSGPMQLFRLCFVDILRSKVLNSMHALFLVHLNSFKSRKVLLCDSSVTVCV* |
ORF Type | complete |
Blastp | Probable xyloglucan glycosyltransferase 6 from Arabidopsis with 82.19% of identity |
---|---|
Blastx | Probable xyloglucan glycosyltransferase 6 from Arabidopsis with 82.19% of identity |
Eggnog | Glycosyl transferase, family 2(COG1215) |
Kegg | Link to kegg annotations (AT3G07330) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019465305.1) |
Pfam | Glycosyl transferase family 21 (PF13506.5) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer