Protein coding transcript 115996

• Transcript: Ll_transcript_472978
• CDS coordinates: 3-518 (+)
• Peptide sequence: PNNILITHDFEPLVGDFGLARWQPDGDTGVDTRVIGTFGYLAPEYAQSGQITEKADVYSFGVVLVELVTGRKAVDLNRPKGQQCLTEWARPLLEEYAIEELIDPSLGSHYSEHEVYCMLHAASLCIRRDPCSRPRMSQVSEIFYAKFSPTSFTLNKLLACFLELDLDSYRL*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_472978

• Blastp: Inactive protein kinase SELMODRAFT_444075 from Selaginella with 69.84% of identity
• Blastx: Inactive protein kinase SELMODRAFT_444075 from Selaginella with 67.69% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (SELMODRAFT_444075)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019448208.1)
• Pfam: Protein kinase domain (PF00069.24)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;