Protein coding transcript 1160

• Transcript: Ll_transcript_322204
• CDS coordinates: 1-447 (+)
• Peptide sequence: CLRWNNHQSTLVSVFENLLDSGTLIDCTLYADGQLLRAHKVVLTACSPIFESMLKVQEDKHPIIFLKDVKFVEMKAMLDYMYKGEVNILQDNLDSFLKTAAALEIKGLTDQGGGGEGEPPAKKGPGRKTGMSDVAPESPLVGNAPLRDG
• ORF Type: internal

Annotations of Ll_transcript_322204

• Blastp: Longitudinals lacking protein, isoforms H/M/V from Sophophora with 60.94% of identity
• Blastx: Longitudinals lacking protein, isoforms H/M/V from Sophophora with 65.45% of identity
• Eggnog: BTB/POZ domain(ENOG4111M67)
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_003526644.1)
• Pfam: BTB/POZ domain (PF00651.30)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;